ENTRY 54205 CDS T01001 SYMBOL CYCS, CYC, HCS, THC4 NAME (RefSeq) cytochrome c ORTHOLOGY K08738 cytochrome c ORGANISM hsa Homo sapiens (human) PATHWAY hsa00190 Oxidative phosphorylation hsa01100 Metabolic pathways hsa01524 Platinum drug resistance hsa04115 p53 signaling pathway hsa04210 Apoptosis hsa04215 Apoptosis - multiple species hsa04932 Non-alcoholic fatty liver disease hsa05010 Alzheimer disease hsa05012 Parkinson disease hsa05014 Amyotrophic lateral sclerosis hsa05016 Huntington disease hsa05017 Spinocerebellar ataxia hsa05020 Prion disease hsa05022 Pathways of neurodegeneration - multiple diseases hsa05130 Pathogenic Escherichia coli infection hsa05131 Shigellosis hsa05132 Salmonella infection hsa05134 Legionellosis hsa05145 Toxoplasmosis hsa05152 Tuberculosis hsa05160 Hepatitis C hsa05161 Hepatitis B hsa05162 Measles hsa05163 Human cytomegalovirus infection hsa05164 Influenza A hsa05167 Kaposi sarcoma-associated herpesvirus infection hsa05168 Herpes simplex virus 1 infection hsa05169 Epstein-Barr virus infection hsa05170 Human immunodeficiency virus 1 infection hsa05200 Pathways in cancer hsa05210 Colorectal cancer hsa05222 Small cell lung cancer hsa05416 Viral myocarditis hsa05417 Lipid and atherosclerosis NETWORK nt06161 Human immunodeficiency virus 1 (HIV-1) nt06162 Hepatitis B virus (HBV) nt06163 Hepatitis C virus (HCV) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06165 Epstein-Barr virus (EBV) nt06166 Human papillomavirus (HPV) nt06167 Human cytomegalovirus (HCMV) nt06168 Herpes simplex virus 1 (HSV-1) nt06170 Influenza A virus (IAV) nt06231 Apoptosis (cancer) nt06260 Colorectal cancer nt06263 Hepatocellular carcinoma nt06267 Small cell lung cancer nt06460 Alzheimer disease nt06461 Huntington disease nt06462 Spinocerebellar ataxia nt06463 Parkinson disease nt06464 Amyotrophic lateral sclerosis nt06465 Prion disease nt06466 Pathways of neurodegeneration nt06524 Apoptosis nt06528 Calcium signaling ELEMENT N00098 Intrinsic apoptotic pathway N00099 Mutation-inactivated BAX to apoptotic pathway N00100 BCL2-overexpression to intrinsic apoptotic pathway N00146 Crosstalk between extrinsic and intrinsic apoptotic pathways N00449 HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways N00478 EBV BARF1 to intrinsic apoptotic pathway N00745 IAV PB1-F2 to intrinsic apoptotic pathway N00957 Mutation-caused abberant ATXN2/3 to mGluR5-Ca2+ -apoptotic pathway N00967 VGCC-Ca2+ -apoptotic pathway N00984 mGluR5-Ca2+ -apoptotic pathway N00985 Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway N00987 Mutation-caused aberrant Htt to transport of calcium N01000 mAChR-Ca2+ -apoptotic pathway N01001 Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway N01002 Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway N01003 Mutation-caused aberrant Abeta to transport of calcium N01004 Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway N01005 Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways N01006 Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway N01007 Mutation-caused aberrant PSEN to mGluR5-Ca2+ -apoptotic pathway N01008 Mutation-caused aberrant PSEN1 to mGluR5-Ca2+ -apoptotic pathway N01031 Mutation-caused aberrant SNCA to VGCC-Ca2+ -apoptotic pathway N01047 Mutation-activated LRRK2 to intrinsic apoptotic pathway N01048 Mutation-inactivated PINK1 to intrinsic apoptotic pathway N01049 Mutation-inactivated PRKN to intrinsic apoptotic pathway N01050 Mutation-inactivated PINK1 to intrinsic apoptotic pathway N01135 Mutation-caused aberrant SOD1 to intrinsic apoptotic pathway N01151 Mutation-inactivated SIGMAR1 to Ca2+ -apoptotic pathway N01199 Scrapie conformation PrPSc to mGluR5-Ca2+ -apoptotic pathway N01200 Scrapie conformation PrPSc to transport of calcium DISEASE H00978 Thrombocytopenia (THC) BRITE KEGG Orthology (KO) [BR:hsa00001] 09100 Metabolism 09102 Energy metabolism 00190 Oxidative phosphorylation 54205 (CYCS) 09140 Cellular Processes 09143 Cell growth and death 04210 Apoptosis 54205 (CYCS) 04215 Apoptosis - multiple species 54205 (CYCS) 04115 p53 signaling pathway 54205 (CYCS) 09160 Human Diseases 09161 Cancer: overview 05200 Pathways in cancer 54205 (CYCS) 09162 Cancer: specific types 05210 Colorectal cancer 54205 (CYCS) 05222 Small cell lung cancer 54205 (CYCS) 09172 Infectious disease: viral 05170 Human immunodeficiency virus 1 infection 54205 (CYCS) 05161 Hepatitis B 54205 (CYCS) 05160 Hepatitis C 54205 (CYCS) 05164 Influenza A 54205 (CYCS) 05162 Measles 54205 (CYCS) 05168 Herpes simplex virus 1 infection 54205 (CYCS) 05163 Human cytomegalovirus infection 54205 (CYCS) 05167 Kaposi sarcoma-associated herpesvirus infection 54205 (CYCS) 05169 Epstein-Barr virus infection 54205 (CYCS) 09171 Infectious disease: bacterial 05130 Pathogenic Escherichia coli infection 54205 (CYCS) 05132 Salmonella infection 54205 (CYCS) 05131 Shigellosis 54205 (CYCS) 05134 Legionellosis 54205 (CYCS) 05152 Tuberculosis 54205 (CYCS) 09174 Infectious disease: parasitic 05145 Toxoplasmosis 54205 (CYCS) 09164 Neurodegenerative disease 05010 Alzheimer disease 54205 (CYCS) 05012 Parkinson disease 54205 (CYCS) 05014 Amyotrophic lateral sclerosis 54205 (CYCS) 05016 Huntington disease 54205 (CYCS) 05017 Spinocerebellar ataxia 54205 (CYCS) 05020 Prion disease 54205 (CYCS) 05022 Pathways of neurodegeneration - multiple diseases 54205 (CYCS) 09166 Cardiovascular disease 05417 Lipid and atherosclerosis 54205 (CYCS) 05416 Viral myocarditis 54205 (CYCS) 09167 Endocrine and metabolic disease 04932 Non-alcoholic fatty liver disease 54205 (CYCS) 09176 Drug resistance: antineoplastic 01524 Platinum drug resistance 54205 (CYCS) POSITION 7:complement(25118656..25125260) MOTIF Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG DBLINKS NCBI-GeneID: 54205 NCBI-ProteinID: NP_061820 OMIM: 123970 HGNC: 19986 Ensembl: ENSP00000307786.2 UniProt: P99999 G4XXL9 STRUCTURE PDB AASEQ 105 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE NTSEQ 318 atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggcggaag acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcatctgg ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa aaagctactaatgagtaa ///